DHX34 anticorps

N° du produit ABIN633572

L’anticorps Lapin Polyclonal anti-DHX34 a été validé pour WB. Il convient pour détecter DHX34 dans des échantillons de Humain.

Aperçu rapide pour DHX34 anticorps (ABIN633572)

Antigène: DHX34 (DEAH (Asp-Glu-Ala-His) Box Polypeptide 34 (DHX34))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DHX34 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-DHX34 anticorps

Purification: Affinity purified

Immunogène: DHX34 antibody was raised using a synthetic peptide corresponding to a region with amino acids APQDGPPGAEEAALETLQKTSVLQRPYHCEACGKDFLFTPTEVLRHRKQH

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DHX34 Blocking Peptide, (ABIN936820), is also available for use as a blocking control in assays to test for specificity of this DHX34 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DHX34 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DHX34

Antigène: DHX34 (DEAH (Asp-Glu-Ala-His) Box Polypeptide 34 (DHX34))

Autre désignation: DHX34

Sujet: DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation.

Poids moléculaire: 128 kDa (MW of target protein)